Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A8MPX8-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MSTNNALR PA
2
20-34 (15) TSTFDSDEDILLLPK PA
2
52-70 (19) HEEEQVYEQGTTLPCSICK PA
2
71-82 (12) HEIDLTGIFLHK PA
2
84-98 (15) QHVALATLGFQWMGR PA
2
100-110 (11) KPQPSVIAVQR PA
2
117-126 (10) LLSSFMFTEK PA
2
127-140 (14) TLQSINNAFELLWK PA
2
170-177 (8) GVGICEDR PA
2
189-233 (45) FTVVSNFGNKPNVCFFGLFDGHHGASAAELTSMELPVLLLHQLSK PA
2
234-256 (23) FDPSYQMTTDEQQIINSFYTVFR PA
2
257-271 (15) EEYAAIEDLFSAINK PA
2
277-284 (8) CEYEDTHK PA
2
307-324 (18) VQWSGCSAVTCILEGKPK PA
2
336-352 (17) NTHDGLAESSPSQEMPK PA
2
353-372 (20) IISGILHVANTGNVQAVLCR PA
0
394-415 (22) ILQNGAVISSNEPYGLVEGQVK PA
0
419-427 (9) GLGFHGNLK PA
0
431-463 (33) SIIPAPQTISVPIDDLCQFLIVATNGLWEVLDK PA
0
464-478 (15) EEVTALAMTTFHMYK PA
0
479-488 (10) ETYCPIIPNK PA
0
493-506 (14) GPLLFSTSEPNLTK PA
0
507-518 (12) SQSNIHVLFQYK PA
0
532-541 (10) ENLSDSNYSK PA
0
542-560 (19) YCIYNPENVETFPAETTHR PA
0
567-582 (16) VTDRPTSVNDVATNEK PA
0
588-611 (24) SFYEGAAEYVSHELVNAALLAGSR PA
0
612-630 (19) DNITVMVIFLNGSEYQLLT PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center