Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A8MQT2-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MAEETGQSK PA
1
24-33 (10) NRPGVPAAAK PA
1
38-67 (30) ANGSSPETAASGGCHSSEASSSASSSLHAR PA
1
68-81 (14) QSPCQEQAAVLNSR PA
2
101-110 (10) QVEHQLEEEK PA
11
122-129 (8) ELEGQIQR PA
2
137-145 (9) LNTDLYHMK PA
3
169-184 (16) IGELEWSLCAVAATQK PA
3
186-193 (8) KPDGFSSR PA
3
231-238 (8) DQYAEQIK PA
3
251-259 (9) MSQEVCTLK PA
3
281-304 (24) NQMAEPLPPDAPAVSSEVELQDLR PA
3
310-329 (20) VAGELQAQVENNQCISLLNR PA
3
356-370 (15) LQQLAEPQSDLEELK PA
3
375-384 (10) SALQLEQQVK PA
5
390-402 (13) LGQVMETLTSAEK PA
3
403-427 (25) EPEAAVPASGTGGESSGLMDLLEEK PA
3
437-445 (9) LELGFIQYR PA
3
456-465 (10) LLTEPGDSAK PA
3
466-507 (42) DASPGGGHHQAGPGQGGEEGEAAGAAGDGVAACGSYSEGHGK PA
3
514-534 (21) NPAAEPSPGAPAPQELGAADK PA
3
535-555 (21) HGDLCEASLTNSVEPAQGEAR PA
3
556-600 (45) EGSSQDNPTAQPVLQLLGEMQDHQEHPGLGSNCCVPCFCWAWLPR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center