Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A8MQT2-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
26-41 (16) IGELEWSLCAVAATQK PA
3
43-50 (8) KPDGFSSR PA
3
88-95 (8) DQYAEQIK PA
3
108-116 (9) MSQEVCTLK PA
3
138-161 (24) NQMAEPLPPDAPAVSSEVELQDLR PA
3
167-186 (20) VAGELQAQVENNQCISLLNR PA
3
213-227 (15) LQQLAEPQSDLEELK PA
3
232-241 (10) SALQLEQQVK PA
5
247-259 (13) LGQVMETLTSAEK PA
3
260-284 (25) EPEAAVPASGTGGESSGLMDLLEEK PA
3
294-302 (9) LELGFIQYR PA
3
313-322 (10) LLTEPGDSAK PA
3
323-364 (42) DASPGGGHHQAGPGQGGEEGEAAGAAGDGVAACGSYSEGHGK PA
3
371-391 (21) NPAAEPSPGAPAPQELGAADK PA
3
392-412 (21) HGDLCEASLTNSVEPAQGEAR PA
3
413-457 (45) EGSSQDNPTAQPVLQLLGEMQDHQEHPGLGSNCCVPCFCWAWLPR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center