Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A8MT70-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-19 (15) DFVVLPWGKPGNSVK PA
1
33-44 (12) VQLEFENQEMEK PA
2
61-68 (8) ESSEYYWK PA
2
75-86 (12) LVNQSYMMSQNK PA
2
104-117 (14) EQIQEPVKPTVNYK PA
2
118-128 (11) MANSSECEKPK PA
2
133-140 (8) VCGQCENK PA
2
141-160 (20) AALLVCLECGEDYCSGCFAK PA
2
179-194 (16) SQILFNVLDVAHQFIK PA
2
195-202 (8) DVNPDEPK PA
2
226-236 (11) SSSEVEITTMK PA
2
246-270 (25) SLLCEGSFDEEASAQSFQEVLSQWR PA
2
271-278 (8) TGNHDDNK PA
2
280-287 (8) QNLHAAVK PA
2
288-300 (13) DSLEECEVQTNLK PA
2
304-311 (8) EPLNIELK PA
2
312-320 (9) EDILSYMEK PA
2
329-336 (8) TPQEQLFK PA
2
337-369 (33) MLPDTFPHPHETTGDAQCSQNENDEDSDGEETK PA
2
370-392 (23) VQHTALLLPVETLNIERPEPSLK PA
2
393-414 (22) IVELDDTYEEEFEEAENIVPYK PA
2
417-424 (8) LADADSQR PA
2
425-433 (9) SCAFHDCQK PA
2
434-450 (17) NSFPYENGIHQHHVFDK PA
2
454-461 (8) DFLNLCLR PA
2
473-495 (23) AETSNTDFDNIVDPDVYSSDIEK PA
2
496-504 (9) IEESTSFER PA
2
510-518 (9) NIGLESNQK PA
2
519-529 (11) SDDSCVSLESK PA
2
552-561 (10) ESLELSNLYK PA
2
562-569 (8) RPSFEESK PA
2
573-583 (11) SSLLLQEIACR PA
2
597-605 (9) FFIFDTNER PA
2
606-613 (8) LNLLPSHR PA
2
614-622 (9) LECNNSSTR PA
2
630-645 (16) SQRPSTANFPLSNSVK PA
2
646-657 (12) ESSSCLSSSHPR PA
2
660-668 (9) SAAAQSSSR PA
2
669-703 (35) AASEISEIEYIDITDQNELSLDDTTDQHTLDNLEK PA
2
710-717 (8) SLADTSEK PA
2
718-745 (28) LYSLTSEEFPDFSSQSLNISQISTDFLK PA
2
751-763 (13) GPCGVEELSCSGR PA
2
767-788 (22) IQSLLSLSESSTDEEEEDFLNK PA
2
789-798 (10) QHVITLPWSK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center