Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A8MT70-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-15 (12) VQLEFENQEMEK PA
2
32-39 (8) ESSEYYWK PA
2
46-57 (12) LVNQSYMMSQNK PA
2
75-88 (14) EQIQEPVKPTVNYK PA
2
89-99 (11) MANSSECEKPK PA
2
104-111 (8) VCGQCENK PA
2
112-131 (20) AALLVCLECGEDYCSGCFAK PA
2
150-165 (16) SQILFNVLDVAHQFIK PA
2
166-173 (8) DVNPDEPK PA
2
197-207 (11) SSSEVEITTMK PA
2
217-241 (25) SLLCEGSFDEEASAQSFQEVLSQWR PA
2
242-249 (8) TGNHDDNK PA
2
251-258 (8) QNLHAAVK PA
2
259-271 (13) DSLEECEVQTNLK PA
2
275-282 (8) EPLNIELK PA
2
283-291 (9) EDILSYMEK PA
2
300-307 (8) TPQEQLFK PA
2
308-340 (33) MLPDTFPHPHETTGDAQCSQNENDEDSDGEETK PA
2
341-363 (23) VQHTALLLPVETLNIERPEPSLK PA
2
364-385 (22) IVELDDTYEEEFEEAENIVPYK PA
2
388-395 (8) LADADSQR PA
2
396-404 (9) SCAFHDCQK PA
2
405-421 (17) NSFPYENGIHQHHVFDK PA
2
425-432 (8) DFLNLCLR PA
2
444-466 (23) AETSNTDFDNIVDPDVYSSDIEK PA
2
467-475 (9) IEESTSFER PA
2
481-489 (9) NIGLESNQK PA
2
490-500 (11) SDDSCVSLESK PA
2
523-532 (10) ESLELSNLYK PA
2
533-540 (8) RPSFEESK PA
2
544-554 (11) SSLLLQEIACR PA
2
568-576 (9) FFIFDTNER PA
2
577-584 (8) LNLLPSHR PA
2
585-593 (9) LECNNSSTR PA
2
601-616 (16) SQRPSTANFPLSNSVK PA
2
617-628 (12) ESSSCLSSSHPR PA
2
631-639 (9) SAAAQSSSR PA
2
640-674 (35) AASEISEIEYIDITDQNELSLDDTTDQHTLDNLEK PA
2
681-688 (8) SLADTSEK PA
2
689-716 (28) LYSLTSEEFPDFSSQSLNISQISTDFLK PA
2
722-734 (13) GPCGVEELSCSGR PA
2
738-759 (22) IQSLLSLSESSTDEEEEDFLNK PA
2
760-769 (10) QHVITLPWSK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center