Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A8MTZ7-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-16 (16) MAYSSSNSDIEDDSSK PA
0
17-47 (31) SNSNLSLSVGYFPCEDTPCEDTTSWEDAPSK PA
0
48-65 (18) GPSIHFLPPVQGAWGTER PA
0
73-85 (13) QDQIQDEPEQFCK PA
0
86-104 (19) LSIFLAWDVDIGSDNTDSR PA
0
108-118 (11) LLNGDNLWIDK PA
0
131-146 (16) LNNLVQEFQIFLENLK PA
0
147-182 (36) DDDAVFPETAQQDFQLSSGSPPEMVQMISQATASQR PA
0
183-198 (16) TSAPEISSILSEQPEK PA
0
199-221 (23) DDTPSHTQAQCCLNFGWAFSWLR PA
0
232-239 (8) DHPVNATK PA
0
257-269 (13) IQPQETLELGHPI PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center