Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A8MUM7-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MSFLTVPYK PA
0
10-23 (14) LPVSLSVGSCVIIK PA
1
24-55 (32) GTLIDSSINEPQLQVDFYTEMNEDSEIAFHLR PA
0
68-92 (25) EFGIWMLEENLHYVPFEDGKPFDLR PA
0
93-103 (11) IYVCLNEYEVK PA
0
104-115 (12) VNGEYIYAFVHR PA
0
129-141 (13) DVSLDSVLVNNGR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center