Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A8MVS5-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-21 (21) MPWTILLFAAGSLAIPAPSIR PA
0
22-53 (32) LVPPYPSSQEDPIHIACMAPGNFPGANFTLYR PA
0
54-68 (15) GGQVVQLLQAPTDQR PA
0
69-80 (12) GVTFNLSGGSSK PA
0
81-143 (63) APGGPFHCQYGVLGELNQSQLSDLSEPVNVSFPVPTWILVLSLSLAGALFLLAGLVAVALVVR PA
0
157-182 (26) ESCWAQINFDSTDMSFDNSLFTVSAK PA
0
183-206 (24) TMPEEDPATLDDHSGTTATPSNSR PA
0
210-227 (18) RPTSTSSSPETPEFSTFR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center