Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A8MVW5-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-20 (20) MGQDAFMEPFGDTLGVFQCK PA
1
21-33 (13) IYLLLFGACSGLK PA
0
34-45 (12) VTVPSHTVHGVR PA
2
46-78 (33) GQALYLPVHYGFHTPASDIQIIWLFERPHTMPK PA
2
79-86 (8) YLLGSVNK PA
2
87-97 (11) SVVPDLEYQHK PA
2
98-123 (26) FTMMPPNASLLINPLQFPDEGNYIVK PA
2
124-137 (14) VNIQGNGTLSASQK PA
2
138-177 (40) IQVTVDDPVTKPVVQIHPPSGAVEYVGNMTLTCHVEGGTR PA
2
185-211 (27) NGRPVHTSSTYSFSPQNNTLHIAPVTK PA
2
212-222 (11) EDIGNYSCLVR PA
2
223-250 (28) NPVSEMESDIIMPIIYYGPYGLQVNSDK PA
2
254-284 (31) VGEVFTVDLGEAILFDCSADSHPPNTYSWIR PA
2
286-294 (9) TDNTTYIIK PA
2
310-324 (15) TMDYVCCAYNNITGR PA
2
325-341 (17) QDETHFTVIITSVGLEK PA
2
348-373 (26) SLSPLASITGISLFLIISMCLLFLWK PA
2
385-394 (10) LEGRPETEYR PA
2
396-425 (30) AQTFSGHEDALDDFGIYEFVAFPDVSGVSR PA
2
430-462 (33) SVPASDCVSGQDLHSTVYEVIQHIPAQQQDHPE PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center