Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A8MVW5-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-21 (17) VFTTFLSFATGACSGLK PA
0
22-33 (12) VTVPSHTVHGVR PA
2
34-66 (33) GQALYLPVHYGFHTPASDIQIIWLFERPHTMPK PA
2
67-74 (8) YLLGSVNK PA
2
75-85 (11) SVVPDLEYQHK PA
2
86-111 (26) FTMMPPNASLLINPLQFPDEGNYIVK PA
2
112-125 (14) VNIQGNGTLSASQK PA
2
126-165 (40) IQVTVDDPVTKPVVQIHPPSGAVEYVGNMTLTCHVEGGTR PA
2
173-199 (27) NGRPVHTSSTYSFSPQNNTLHIAPVTK PA
2
200-210 (11) EDIGNYSCLVR PA
2
211-238 (28) NPVSEMESDIIMPIIYYGPYGLQVNSDK PA
2
242-272 (31) VGEVFTVDLGEAILFDCSADSHPPNTYSWIR PA
2
274-282 (9) TDNTTYIIK PA
2
298-312 (15) TMDYVCCAYNNITGR PA
2
313-329 (17) QDETHFTVIITSVGLEK PA
2
336-361 (26) SLSPLASITGISLFLIISMCLLFLWK PA
2
373-382 (10) LEGRPETEYR PA
2
384-413 (30) AQTFSGHEDALDDFGIYEFVAFPDVSGVSR PA
2
418-450 (33) SVPASDCVSGQDLHSTVYEVIQHIPAQQQDHPE PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center