Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A8MVW5-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-20 (20) MGQDAFMEPFGDTLGVFQCK PA
1
21-36 (16) IYLLLFDIVANCLLLR PA
0
39-48 (10) LSVSSYEIWK PA
0
57-68 (12) VTVPSHTVHGVR PA
2
69-101 (33) GQALYLPVHYGFHTPASDIQIIWLFERPHTMPK PA
2
102-109 (8) YLLGSVNK PA
2
110-120 (11) SVVPDLEYQHK PA
2
121-146 (26) FTMMPPNASLLINPLQFPDEGNYIVK PA
2
147-160 (14) VNIQGNGTLSASQK PA
2
161-200 (40) IQVTVDDPVTKPVVQIHPPSGAVEYVGNMTLTCHVEGGTR PA
2
208-234 (27) NGRPVHTSSTYSFSPQNNTLHIAPVTK PA
2
235-245 (11) EDIGNYSCLVR PA
2
246-273 (28) NPVSEMESDIIMPIIYYGPYGLQVNSDK PA
2
277-307 (31) VGEVFTVDLGEAILFDCSADSHPPNTYSWIR PA
2
309-317 (9) TDNTTYIIK PA
2
333-347 (15) TMDYVCCAYNNITGR PA
2
348-364 (17) QDETHFTVIITSVGLEK PA
2
371-396 (26) SLSPLASITGISLFLIISMCLLFLWK PA
2
408-417 (10) LEGRPETEYR PA
2
419-448 (30) AQTFSGHEDALDDFGIYEFVAFPDVSGVSR PA
2
453-485 (33) SVPASDCVSGQDLHSTVYEVIQHIPAQQQDHPE PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center