Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A8MWY0-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
13-22 (10) GWGRPAEAPR PA
0
26-64 (39) SPPWSPAWICCWALAGCQAAWAGDLPSSSSRPLPPCQEK PA
0
65-79 (15) DYHFEYTECDSSGSR PA
0
82-99 (18) VAIPNSAVDCSGLPDPVR PA
0
102-116 (15) ECTFSCASGEYLEMK PA
0
123-135 (13) CGEGTYSLGSGIK PA
0
136-175 (40) FDEWDELPAGFSNIATFMDTVVGPSDSRPDGCNNSSWIPR PA
0
176-183 (8) GNYIESNR PA
1
184-197 (14) DDCTVSLIYAVHLK PA
1
199-233 (35) SGYVFFEYQYVDNNIFFEFFIQNDQCQEMDTTTDK PA
1
237-251 (15) LTDNGEWGSHSVMLK PA
1
252-260 (9) SGTNILYWR PA
2
261-269 (9) TTGILMGSK PA
2
270-277 (8) AVKPVLVK PA
2
278-312 (35) NITIEGVAYTSECFPCKPGTFSNKPGSFNCQVCPR PA
2
328-349 (22) DDSQFSEEGSSECTERPPCTTK PA
2
350-363 (14) DYFQIHTPCDEEGK PA
2
378-385 (8) EDLTDAIR PA
2
394-423 (30) DCPPCNPGFYNNGSSSCHPCPPGTFSDGTK PA
2
424-441 (18) ECRPCPAGTEPALGFEYK PA
2
442-451 (10) WWNVLPGNMK PA
2
452-461 (10) TSCFNVGNSK PA
2
462-512 (51) CDGMNGWEVAGDHIQSGAGGSDNDYLILNLHIPGFKPPTSMTGATGSELGR PA
2
513-535 (23) ITFVFETLCSADCVLYFMVDINR PA
2
537-548 (12) STNVVESWGGTK PA
2
551-559 (9) QAYTHIIFK PA
2
560-571 (12) NATFTFTWAFQR PA
2
572-579 (8) TNQGQDNR PA
2
588-605 (18) IYSITATNAVDGVASSCR PA
2
606-629 (24) ACALGSEQSGSSCVPCPPGHYIEK PA
2
636-651 (16) ECPPDTYLSIHQVYGK PA
2
652-662 (11) EACIPCGPGSK PA
2
663-680 (18) NNQDHSVCYSDCFFYHEK PA
2
681-707 (27) ENQSLHYDFSNLSSVGSLMNGPSFTSK PA
2
711-725 (15) YFHFFNISLCGHEGK PA
2
727-740 (14) MALCTNNITDFTVK PA
2
741-768 (28) EIVAGSDDYTNLVGAFVCQSTIIPSESK PA
2
772-795 (24) AALSSQSIILADTFIGVTVETTLK PA
2
801-819 (19) EDMFPVPTSQIPDVHFFYK PA
2
820-831 (12) SSTATTSCINGR PA
2
844-854 (11) SGAGVISVPSK PA
2
855-891 (37) CPAGTCDGCTFYFLWESAEACPLCTEHDFHEIEGACK PA
2
893-905 (13) GFQETLYVWNEPK PA
2
918-929 (12) LATCETVDFWLK PA
2
930-951 (22) VGAGVGAFTAVLLVALTCYFWK PA
2
963-970 (8) LVMTTNSK PA
2
971-997 (27) ECELPAADSCAIMEGEDNEEEVVYSNK PA
2
1013-1022 (10) EDHFESVQLK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center