Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A8MWY0-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MLEGNYQVMLK PA
0
12-20 (9) SGTNILYWR PA
2
21-29 (9) TTGILMGSK PA
2
30-37 (8) AVKPVLVK PA
2
38-72 (35) NITIEGVAYTSECFPCKPGTFSNKPGSFNCQVCPR PA
2
88-109 (22) DDSQFSEEGSSECTERPPCTTK PA
2
110-123 (14) DYFQIHTPCDEEGK PA
2
138-145 (8) EDLTDAIR PA
2
154-183 (30) DCPPCNPGFYNNGSSSCHPCPPGTFSDGTK PA
2
184-201 (18) ECRPCPAGTEPALGFEYK PA
2
202-211 (10) WWNVLPGNMK PA
2
212-221 (10) TSCFNVGNSK PA
2
222-272 (51) CDGMNGWEVAGDHIQSGAGGSDNDYLILNLHIPGFKPPTSMTGATGSELGR PA
2
273-295 (23) ITFVFETLCSADCVLYFMVDINR PA
2
297-308 (12) STNVVESWGGTK PA
2
311-319 (9) QAYTHIIFK PA
2
320-331 (12) NATFTFTWAFQR PA
2
332-339 (8) TNQGQDNR PA
2
348-365 (18) IYSITATNAVDGVASSCR PA
2
366-389 (24) ACALGSEQSGSSCVPCPPGHYIEK PA
2
396-411 (16) ECPPDTYLSIHQVYGK PA
2
412-422 (11) EACIPCGPGSK PA
2
423-440 (18) NNQDHSVCYSDCFFYHEK PA
2
441-467 (27) ENQSLHYDFSNLSSVGSLMNGPSFTSK PA
2
471-485 (15) YFHFFNISLCGHEGK PA
2
487-500 (14) MALCTNNITDFTVK PA
2
501-528 (28) EIVAGSDDYTNLVGAFVCQSTIIPSESK PA
2
532-555 (24) AALSSQSIILADTFIGVTVETTLK PA
2
561-579 (19) EDMFPVPTSQIPDVHFFYK PA
2
580-591 (12) SSTATTSCINGR PA
2
604-614 (11) SGAGVISVPSK PA
2
615-651 (37) CPAGTCDGCTFYFLWESAEACPLCTEHDFHEIEGACK PA
2
653-665 (13) GFQETLYVWNEPK PA
2
678-689 (12) LATCETVDFWLK PA
2
690-711 (22) VGAGVGAFTAVLLVALTCYFWK PA
2
723-730 (8) LVMTTNSK PA
2
731-757 (27) ECELPAADSCAIMEGEDNEEEVVYSNK PA
2
773-782 (10) EDHFESVQLK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center