Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A8MWY0-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MHSSWIPR PA
0
9-16 (8) GNYIESNR PA
1
17-30 (14) DDCTVSLIYAVHLK PA
1
32-66 (35) SGYVFFEYQYVDNNIFFEFFIQNDQCQEMDTTTDK PA
1
70-84 (15) LTDNGEWGSHSVMLK PA
1
85-93 (9) SGTNILYWR PA
2
94-102 (9) TTGILMGSK PA
2
103-110 (8) AVKPVLVK PA
2
111-145 (35) NITIEGVAYTSECFPCKPGTFSNKPGSFNCQVCPR PA
2
161-182 (22) DDSQFSEEGSSECTERPPCTTK PA
2
183-196 (14) DYFQIHTPCDEEGK PA
2
211-218 (8) EDLTDAIR PA
2
227-256 (30) DCPPCNPGFYNNGSSSCHPCPPGTFSDGTK PA
2
257-274 (18) ECRPCPAGTEPALGFEYK PA
2
275-284 (10) WWNVLPGNMK PA
2
285-294 (10) TSCFNVGNSK PA
2
295-345 (51) CDGMNGWEVAGDHIQSGAGGSDNDYLILNLHIPGFKPPTSMTGATGSELGR PA
2
346-368 (23) ITFVFETLCSADCVLYFMVDINR PA
2
370-381 (12) STNVVESWGGTK PA
2
384-392 (9) QAYTHIIFK PA
2
393-404 (12) NATFTFTWAFQR PA
2
405-412 (8) TNQGQDNR PA
2
421-438 (18) IYSITATNAVDGVASSCR PA
2
439-462 (24) ACALGSEQSGSSCVPCPPGHYIEK PA
2
469-484 (16) ECPPDTYLSIHQVYGK PA
2
485-495 (11) EACIPCGPGSK PA
2
496-513 (18) NNQDHSVCYSDCFFYHEK PA
2
514-540 (27) ENQSLHYDFSNLSSVGSLMNGPSFTSK PA
2
544-558 (15) YFHFFNISLCGHEGK PA
2
560-573 (14) MALCTNNITDFTVK PA
2
574-601 (28) EIVAGSDDYTNLVGAFVCQSTIIPSESK PA
2
605-628 (24) AALSSQSIILADTFIGVTVETTLK PA
2
634-652 (19) EDMFPVPTSQIPDVHFFYK PA
2
653-664 (12) SSTATTSCINGR PA
2
677-687 (11) SGAGVISVPSK PA
2
688-724 (37) CPAGTCDGCTFYFLWESAEACPLCTEHDFHEIEGACK PA
2
726-738 (13) GFQETLYVWNEPK PA
2
751-762 (12) LATCETVDFWLK PA
2
763-784 (22) VGAGVGAFTAVLLVALTCYFWK PA
2
796-803 (8) LVMTTNSK PA
2
804-830 (27) ECELPAADSCAIMEGEDNEEEVVYSNK PA
2
846-855 (10) EDHFESVQLK PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center