Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A8MXV4-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MSSSLRPGPSR PA
0
15-43 (29) AASIVLAAGWSRPETATPPSRPPPAEGFR PA
0
50-72 (23) SPHQGFMPGAHVFSGGVLDAADR PA
0
73-88 (16) SADWLGLFAPHHGPPR PA
0
89-98 (10) FGLGPAPFSR PA
0
99-111 (13) TAFPSLPDTDDHK PA
0
112-125 (14) TDNTGTLPEDVAFR PA
0
131-144 (14) EAFEEAGVLLLRPR PA
0
145-168 (24) TSPPGPAPGPGLALEPPPGLASWR PA
0
181-206 (26) LCAHLDCTPDIWALHNWSAWLTPFLR PA
0
212-222 (11) FDTAFFLCCLR PA
0
223-252 (30) EPPPVYPDLAEVVGYQWSSPSEATESFLSK PA
0
253-265 (13) EIWLPPPQFYEVR PA
0
267-278 (12) LANFASLSDLHK PA
0
291-327 (37) WLPIILLTADGMVHLLPGDELYLEDSDFLENLMSTEK PA
0
348-359 (12) HLYDIHVTVQPK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center