Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A8MXY4-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-30 (30) MGSLTFWDVTIEFALEEWQCLDMAQQNLYR PA
0
31-38 (8) NVMLENYR PA
19
39-49 (11) NLVFLGIAVSK PA
1
50-57 (8) LDLITCLK PA
0
68-92 (25) HEMVTKPPVISSHFTQDFWPDQSIK PA
0
93-101 (9) DSFQEIILR PA
0
116-124 (9) DCESVNEGK PA
0
125-132 (8) MHEEAYNK PA
0
133-143 (11) LNQCWTTTQGK PA
0
181-192 (12) SFFMLSHLIQHK PA
0
221-230 (10) IIHTEDKPYK PA
1
237-246 (10) AFNISSMFTK PA
0
265-274 (10) VFNNSSTLMK PA
0
305-314 (10) AIHTGEKPYK PA
10
321-329 (9) AFNHFSALR PA
0
331-338 (8) HQIIHTGK PA
9
349-357 (9) AFSQSSTLR PA
1
359-370 (12) HEIIHTEEKPYK PA
0
377-385 (9) AFSNLSALR PA
0
387-398 (12) HEIIHTGQKPYK PA
0
417-426 (10) VIHTAEKPCK PA
1
461-469 (9) AFSNFSALR PA
0
471-482 (12) HEIIHTGEKPYK PA
4
501-510 (10) VIHMEEKPCK PA
0
545-554 (10) AFNNSSTLMK PA
0
585-594 (10) AIHTGEKPYK PA
10
601-609 (9) AFNHFSALR PA
0
611-618 (8) HQIIHTGK PA
9
629-637 (9) AFSQSSTLR PA
1
639-650 (12) HEIIHTGEKPYK PA
4
669-678 (10) VIHTEEKPYK PA
0
685-693 (9) AFNHFSALR PA
0
713-721 (9) AFSQSSTLR PA
1
723-734 (12) HEIIHTGEKPYK PA
4
753-762 (10) VIHTAEKPCK PA
1
797-805 (9) AFNNSSTLR PA
0
807-815 (9) HEIIHTGEK PA
0
853-864 (12) LLNISQPLENMR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center