Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A8MZ59-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MHPSLATMGK PA
0
15-23 (9) LQLDLSVVK PA
0
39-57 (19) QQMQTRPSLGPANQTTSVK PA
0
59-86 (28) EETPSAITTANIRPVSPGISDANDHDLR PA
0
93-102 (10) NPGGASASAR PA
0
103-137 (35) VSSWDSQSYDIEQICLGASNPPWASTLFEIDEFVK PA
0
138-168 (31) IYDLPGEDDTSSLNQYLFPVCLEYDQLQSSV PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center