Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A9Z1Z3-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-21 (21) MWIDIFPQDVPAPPPVDIKPR PA
0
22-29 (8) QPISYELR PA
1
30-57 (28) VVIWNTEDVVLDDENPLTGEMSSDIYVK PA
1
68-86 (19) QETDVHFNSLTGEGNFNWR PA
1
91-98 (8) FDYLPTER PA
1
106-117 (12) SGPFALEEAEFR PA
1
118-131 (14) QPAVLVLQVWDYDR PA
1
132-150 (19) ISANDFLGSLELQLPDMVR PA
1
154-164 (11) GPELCSVQLAR PA
1
197-205 (9) EAQEAQAGK PA
1
215-235 (21) GRPEDLEFTDMGGNVYILTGK PA
1
236-250 (15) VEAEFELLTVEEAEK PA
1
259-270 (12) QPEPLEKPSRPK PA
1
271-281 (11) TSFNWFVNPLK PA
1
282-289 (8) TFVFFIWR PA
1
294-328 (35) TLVLLLLVLLTVFLLLVFYTIPGQISQVIFRPLHK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center