Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_A9Z1Z3-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
11-22 (12) ALAHGDPFQVSR PA
2
23-37 (15) AQDFQVGVTVLEAQK PA
2
38-55 (18) LVGVNINPYVAVQVGGQR PA
2
63-81 (19) GTSCPFYNEYFLFEFHDTR PA
2
84-105 (22) LQDLLLEITAFHSQTLPFMATR PA
1
111-127 (17) MDLGIILDQPDGQFYQR PA
1
128-135 (8) WVPLHDPR PA
1
155-174 (20) GDLPPPMLPPAPGHCSDIEK PA
1
181-190 (10) GVPAERPWAR PA
1
198-205 (8) AEGLPALR PA
1
206-214 (9) LGLLGSLVR PA
1
221-228 (8) VLVEPYVR PA
1
229-264 (36) VSFLGQEGETSVSAEAAAPEWNEQLSFVELFPPLTR PA
1
272-289 (18) DDAPLVDAALATHVPDLR PA
1
297-321 (25) AAGFNPTFGPAWVPLYGSPPGAGLR PA
1
322-338 (17) DSLQGLNEGVGQGIWFR PA
1
341-353 (13) LLLAVSMQVLEGR PA
1
354-369 (16) AEPEPPQAQQGSTLSR PA
1
386-404 (19) AVPQHLDASPGAEGPEIPR PA
1
405-456 (52) AMEVEVEELLPLPENVLAPCEDFLLFGVLFEATMIDPTVASQPISFEISIGR PA
1
470-493 (24) AGEGTEGAAVEAQPLLGARPEEEK PA
1
494-538 (45) EEEELGTHAQRPEPMDGSGPYFCLPLCHCKPCMHVWSCWEDHTWR PA
1
539-546 (8) LQSSNCVR PA
1
552-561 (10) LDQGLQEVER PA
1
565-575 (11) KPGPGACAQLK PA
1
576-586 (11) QALEVLVAGSR PA
1
587-594 (8) QFCHGAER PA
1
596-605 (10) TMTRPNALDR PA
1
610-620 (11) LLVHSLNLLAK PA
1
650-671 (22) FLAEEPQPPLPDVLVWMLSGQR PA
1
678-692 (15) IPAQDVLFSVVEEER PA
1
699-717 (19) IQSLMLTAPGAAPGEVCAK PA
1
732-755 (24) ACTSELPPDLLPEPSAGLPSSLHR PA
1
756-764 (9) DDFSYFQLR PA
1
772-787 (16) GVLAADDSGLSDPFAR PA
1
788-798 (11) VLISTQCQTTR PA
1
799-822 (24) VLEQTLSPLWDELLVFEQLIVDGR PA
1
824-842 (19) EHLQEEPPLVIINVFDHNK PA
1
843-851 (9) FGPPVFLGR PA
1
860-876 (17) LMEDPYQRPELQFFPLR PA
1
878-899 (22) GPWAAGELIAAFQLIELDYSGR PA
1
900-923 (24) LEPSVPSEVEPQDLAPLVEPHSGR PA
1
924-935 (12) LSLPPNVCPVLR PA
1
939-947 (9) VEVLFWGLR PA
6
952-980 (29) VHLLEVEQPQVVLEVAGQGVESEVLASYR PA
1
981-990 (10) ESPNFTELVR PA
1
991-1013 (23) HLTVDLPEQPYLQPPLSILVIER PA
1
1015-1032 (18) AFGHTVLVGSHIVPHMLR PA
1
1037-1057 (21) GHEDPPEEEGEMEETGDMMPK PA
1
1064-1076 (13) SLDPFLAEAGISR PA
1
1077-1084 (8) QLLKPPLK PA
1
1086-1113 (28) LPLGGLLNQGPGLEEDIPDPEELDWGSK PA
1
1114-1159 (46) YYASLQELQGQHNFDEDEMDDPGDSDGVNLISMVGEIQDQGEAEVK PA
1
1180-1196 (17) EEFNHFEDWLNVFPLYR PA
1
1197-1216 (20) GQGGQDGGGEEEGSGHLVGK PA
1
1219-1239 (21) GSFLIYPESEAVLFSEPQISR PA
1
1240-1248 (9) GIPQNRPIK PA
1
1258-1269 (12) ATNLAPADPNGK PA
1
1270-1280 (11) ADPYVVVSAGR PA
1
1293-1340 (48) QLNPIFGEILELSISLPAETELTVAVFDHDLVGSDDLIGETHIDLENR PA
1
1347-1367 (21) ANCGLASQYEVWVQQGPQEPF PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center