Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_B0I1T2-4)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-27 (27) MEDEEGPEYGKPDFVLLDQVTMEDFMR PA
3
38-65 (28) IYTYIGEVLVSVNPYQELPLYGPEAIAR PA
3
70-87 (18) ELYERPPHLYAVANAAYK PA
3
95-108 (14) DTCIVISGESGAGK PA
4
114-128 (15) HIMQYIAAVTNPSQR PA
3
141-152 (12) STCVLEAFGNAR PA
3
165-173 (9) YMDINFDFK PA
4
174-188 (15) GDPIGGHIHSYLLEK PA
3
200-209 (10) NFHAFYQLLR PA
2
215-223 (9) QLHELHLER PA
2
224-260 (37) NPAVYNFTHQGAGLNMTVHSALDSDEQSHQAVTEAMR PA
2
261-274 (14) VIGFSPEEVESVHR PA
2
275-297 (23) ILAAILHLGNIEFVETEEGGLQK PA
2
298-319 (22) EGLAVAEEALVDHVAELTATPR PA
2
342-352 (11) GHTAAEASYAR PA
2
363-370 (8) LFEWVVNR PA
2
371-378 (8) INSVMEPR PA
2
388-418 (31) DTVIGVLDIYGFEVFPVNSFEQFCINYCNEK PA
2
419-429 (11) LQQLFIQLILK PA
2
430-437 (8) QEQEEYER PA
2
438-462 (25) EGITWQSVEYFNNATIVDLVERPHR PA
2
463-481 (19) GILAVLDEACSSAGTITDR PA
2
482-492 (11) IFLQTLDMHHR PA
2
493-500 (8) HHLHYTSR PA
2
519-534 (16) HYAGDVTYSVEGFIDK PA
1
537-544 (8) DFLFQDFK PA
1
546-556 (11) LLYNSTDPTLR PA
1
557-571 (15) AMWPDGQQDITEVTK PA
1
572-581 (10) RPLTAGTLFK PA
1
582-594 (13) NSMVALVENLASK PA
1
601-608 (8) CIKPNEDK PA
1
620-632 (13) HQVAYLGLLENVR PA
1
651-669 (19) YWHLTPITPWAIVPVWSPR PA
0
674-695 (22) GSPNSTSQTSIQAGTSTLLASR PA
0
696-720 (25) HQNIWEDMCVSTCMWGHTGGNMGMR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center