Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_B1AKI9-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
4-25 (22) LAAELLLLLGLLLLTLHITVLR PA
0
26-65 (40) GSGAADGPDAAAGNASQAQLQNNLNVGSDTTSETSFSLSK PA
0
70-85 (16) EHLDHQAAHQPFPRPR PA
0
88-97 (10) QETGHPSLQR PA
0
102-115 (14) SFLLDLPNFPDLSK PA
0
116-141 (26) ADINGQNPNIQVTIEVVDGPDSEADK PA
0
142-159 (18) DQHPENKPSWSVPSPDWR PA
0
171-179 (9) ANSGDQDYK PA
0
180-194 (15) YDSTSDDSNFLNPPR PA
0
195-204 (10) GWDHTAPGHR PA
0
210-239 (30) DQPEYDSTDGEGDWSLWSVCSVTCGNGNQK PA
0
243-254 (12) SCGYACTATESR PA
0
255-269 (15) TCDRPNCPGIEDTFR PA
0
270-288 (19) TAATEVSLLAGSEEFNATK PA
0
289-299 (11) LFEVDTDSCER PA
0
315-340 (26) VMNDLPSCPCSYPTEVAYSTADIFDR PA
0
358-366 (9) LEIYKPTAR PA
0
371-396 (26) SMLSLESTTLAAQHCCYGDNMQLITR PA
0
399-417 (19) GAGTPNLISTEFSAELHYK PA
0
418-427 (10) VDVLPWIICK PA
0
433-444 (12) YNEARPPNNGQK PA
0
445-456 (12) CTESPSDEDYIK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center