Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_B2RU33-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-15 (15) MVTEVCSMPAASAVK PA
0
41-55 (15) SNMGTSGDHDDSFMK PA
4
64-73 (10) CCHHCFPCCR PA
2
74-92 (19) GSGTSNVGTSGDHDNSFMK PA
2
101-110 (10) WCCHCFPCCR PA
17
115-132 (18) SNVGAWGDYDDSAFMEPR PA
0
175-195 (21) TALHLASANGNSEVVQLLLDR PA
5
197-205 (9) CQLNVLDNK PA
11
213-252 (40) AVQCQEDECVLMLLEHGADQNIPDEYGNTTLHYAVHNEDK PA
0
257-268 (12) ALLLYGADIESK PA
16
271-284 (14) CGLTPLLLGVHEQK PA
5
296-303 (8) ANLNALDR PA
16
307-342 (36) TALILAVCCGSASIVNLLLEQNVDVSSQDLSGQTAR PA
5
343-361 (19) EYAVSSHHHVICELLSDYK PA
5
368-380 (13) ISSENSNPEQDLK PA
7
381-389 (9) LTSEEESQR PA
12
392-400 (9) VSENSQPEK PA
4
401-409 (9) MSQEPEINK PA
7
422-450 (29) HGSNPVGLPENLTNGASAGNGDDGLIPQR PA
4
454-477 (24) KPENQQFPDTENEEYHSDEQNDTR PA
1
479-497 (19) QLSEEQNTGISQDEILTNK PA
4
508-517 (10) MNSELSLSHK PA
1
525-542 (18) ENSMLQEEIAMLISGDWN PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center