Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_B2RXF0-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-13 (13) MAGSDVDSEGPAR PA
0
20-56 (37) RPGAPGGPGSEAAAGCPEPLSTAEAPAESATLPAWMR PA
0
57-75 (19) LYFYGMHGITLDVLVSSAR PA
0
85-93 (9) MLGFSSPYR PA
0
94-106 (13) CLLHSLTHFALEK PA
0
114-175 (62) CPNAFVFNFLLYPSAHVGLQTLAGQALLLSLGGGAGVAVAPGALDLALQYVLALYHCQVFLK PA
0
189-201 (13) QQQQQQQQQQQQR PA
0
203-212 (10) GALPVPPGAR PA
0
213-220 (8) VPTAAGAR PA
0
229-243 (15) GAGGAPSQGLPDLPR PA
0
244-293 (50) FLFFGMHGFLDEIFFTFFFNVLGQGDGTTSGHTSLWSFFMYGSCSFVVEK PA
0
294-302 (9) LYFHLHYSR PA
0
310-329 (20) VPIYVIFIYVWELSWGLGLR PA
0
330-373 (44) TCGACSWDYSHYPLNFMGLITLMYLPGWIFLSVYQDLISNVLWR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center