Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_B6SEH9-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
5-33 (29) FLFLYLSLLPMPLLSQAQWNENSLVSFSK PA
1
34-53 (20) IIASGNHLSNCWICHNFITR PA
1
54-63 (10) SSSYQYILVR PA
1
64-81 (18) NFSLNLTFGSGIPEGQHK PA
1
82-110 (29) SVPLQVSLANSAHQVPCLDLTPPFNQSSK PA
1
111-135 (25) TSFYFYNCSSLNQTCCPCPEGHCDR PA
1
137-169 (33) NTSEEGFPSPTIHPMSFSPAGCHPNLTHWCPAK PA
1
203-211 (9) AHTVPTWPK PA
1
212-233 (22) STVPLGGPLSPACNQTIPAGWK PA
1
239-246 (8) WFDSHIPR PA
1
247-262 (16) WACTPPGYVFLCGPQK PA
1
265-272 (8) LPFDGSPK PA
1
273-304 (32) ITYSTPPVANLYTCINNIQHTGECAVGLLGPR PA
1
305-317 (13) GIGVTIYNTTQPR PA
1
321-350 (30) ALGLILAGMGAAIGMIAPWGGFTYHDVTLR PA
1
372-385 (14) ASIDSLANVVMDNR PA
0
386-404 (19) LALDYLLAEQGGVCAVINK PA
0
405-421 (17) SCCVYVNNSGAIEEDIK PA
0
423-435 (13) IYDEATWLHDFGK PA
0
449-483 (35) SALPSLNWFVPLLGPATVILLLFLFGPCFFNLLIK PA
0
502-514 (13) YQLSVIGGPSTYK PA
0
515-525 (11) HISPLDASGQR PA
0
528-535 (8) ETMEEFSL PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center