Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_C9J202-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-20 (20) MGATAGWAVTVYDKPASFFK PA
0
21-29 (9) EAPLDLQHR PA
0
34-42 (9) LGSTHSPFR PA
0
45-54 (10) SEPEDPDTER PA
0
61-69 (9) DSGSGLVTR PA
0
70-106 (37) LHERPALLVSSTSWTEFEQLTLDGQNLPSLVCVITGK PA
0
121-135 (15) HFQHIQVCIPWLEGR PA
0
136-162 (27) GLPPLLGSVDLDVCLDTSSSGLDLPMK PA
0
169-179 (11) CCLPACAVNFK PA
0
192-213 (22) LVFEDSEELAAQLQYFADAFLK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center