Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_C9J442-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-34 (34) MLLSLLGACAVVGPFHGPEWEPVQGLLSQNHSCR PA
0
35-54 (20) DPQCCGNLLVLCLFLVWQVR PA
0
55-62 (8) HCWHQVTR PA
0
91-100 (10) LTPEFFSPGK PA
0
103-112 (10) GLDSQQCAQR PA
0
120-169 (50) SLQESWAQNLLSPQHPCPGPPSGVHTHSEPIFCTTSISNTCLLPQNSSWK PA
0
170-202 (33) AWQVPWCLHDGQTRPALDMCQEMEQLLLHSQER PA
0
203-213 (11) LVSLEPVISVR PA
0
214-233 (20) SRPTSMTLTTSLPNLLSAER PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center