Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_C9J7I0-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-20 (14) TSDIEANQPLETNK PA
0
21-36 (16) ENSSSVTVSDPEMENK PA
0
37-87 (51) AGQTLENSSLMAELLSDVPFTLAPHVLAVQGTITDLPDHLLSYDGSENLSR PA
0
88-102 (15) FWYDFTLENSVLCDS PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center