Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_C9JRZ8-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-31 (31) MVLQMEPQVNSTNNFHQGPLDQPVGPLTGLK PA
0
37-55 (19) DTTSAGPLLRPYPASLLGK PA
0
62-69 (8) VAIDAEYR PA
1
70-90 (21) HIDCAYFYENQHEVGEAIQEK PA
1
99-106 (8) EDLFIVSK PA
2
107-118 (12) VWPTFFERPLVR PA
1
130-145 (16) LSYLDVYLIHWPQGFK PA
2
146-153 (8) TGDDFFPK PA
1
164-183 (20) GTFLDAWEAMEELVDEGLVK PA
1
184-197 (14) ALGVSNFNHFQIER PA
1
198-205 (8) LLNKPGLK PA
2
206-223 (18) YKPVTNQVECHPYLTQEK PA
2
224-231 (8) LIQYCHSK PA
2
232-261 (30) GITVTAYSPLGSPDRPWAKPEDPSLLEDPK PA
2
272-279 (8) TTAQVLIR PA
2
292-308 (17) SMTPAHIVENIQVFDFK PA
1
309-322 (14) LSDEEMATILSFNR PA
2
331-344 (14) EFSHLEDFPFDAEY PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center