Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_C9JVW0-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
3-24 (22) GTSCVGGGAESPGGAGLSEGPR PA
0
30-59 (30) LAPVCAYFLCVSLAAVLLAVYYGLIWVPTR PA
0
60-113 (54) SPAAPAGPQPSAPSPPCAARPGVPPVPAPAAASLSCLLGVPGGPRPQLQLPLSR PA
0
131-139 (9) ETPEAAEGR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center