Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_F5GYI3-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MNALDGVPFK PA
0
14-47 (34) GFVIGTEPLPGPELSVPACGEVLLGSMHDFSLER PA
0
48-95 (48) TALFWVEAAGQGPSPYQCGDPGTASAPPAWLLLVSPEHGLAPAPTTIR PA
0
96-140 (45) DPEAGHQERPEEEGEDEAEASSGSEEEPAPSSLQPGSPASPGPGR PA
0
142-149 (8) LCSLDVLR PA
0
183-195 (13) ALSLCPSPAQSPR PA
0
196-226 (31) SASPPGPAPQHPAAPASPPRPSTAGAIPPLR PA
0
227-255 (29) SHKPTVASLSPYTCLPPLGGAPQPLNPHK PA
0
256-287 (32) SHPDTAADLLSALSQEEQDLIGPVVALGYPLR PA
0
299-313 (15) QSLSQFLSYLSACDR PA
0
317-343 (27) QGYEEGLVDEAMEMFQFSESQAGEFLR PA
0
344-357 (14) LWEQFSDMGFQQDR PA
0
360-368 (9) EVLLVHGNR PA
0
370-381 (12) EQALEELVACAQ PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center