Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_F5H4B4-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
7-31 (25) MEVINLTTLPMIPVDEHLAVSLVAR PA
0
41-60 (20) ELENNPPSCLIGSMHQVNQK PA
0
68-79 (12) TEPSANSLAIER PA
0
130-148 (19) NLLAELYQYSNFNSSKPNK PA
1
149-164 (16) LPNGVDFCDMVGNVVR PA
1
184-191 (8) FLSSSSPR PA
1
192-205 (14) AIWLDSFWWIFHER PA
1
211-219 (9) ELQNNLFDR PA
1
220-230 (11) IAQHYALLLFR PA
1
234-242 (9) SHSEEALLK PA
1
251-271 (21) AVYTSFCCCFPQSWFDTHEFK PA
1
272-304 (33) SDICNTMSLWISGTYPSPQSYDSWDYSELDPER PA
1
322-329 (8) EFSLFAGK PA
1
331-340 (10) AFSQKPAQSR PA
1
342-356 (15) FYHPQSSSANSPSEK PA
1
376-385 (10) EHHCQTLVLK PA
1
399-406 (8) ECENMFPK PA
1
414-427 (14) SPELTSNLFNIYGK PA
1
428-446 (19) SPLIVYFLQNYASLQQHGK PA
1
456-478 (23) TTSTPDCTPTYTDVISETLCSMK PA
1
482-500 (19) DNLNQLYQHHWTEWNYFDK PA
1
504-511 (8) ELQDNFSR PA
1
526-543 (18) ANHMFIPPSAVNEESPDK PA
1
557-570 (14) ETEVEHFFPLTSKP PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center