Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_F5H4B4-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
37-55 (19) NLLAELYQYSNFNSSKPNK PA
1
56-71 (16) LPNGVDFCDMVGNVVR PA
1
91-98 (8) FLSSSSPR PA
1
99-112 (14) AIWLDSFWWIFHER PA
1
118-126 (9) ELQNNLFDR PA
1
127-137 (11) IAQHYALLLFR PA
1
141-149 (9) SHSEEALLK PA
1
158-178 (21) AVYTSFCCCFPQSWFDTHEFK PA
1
179-211 (33) SDICNTMSLWISGTYPSPQSYDSWDYSELDPER PA
1
229-236 (8) EFSLFAGK PA
1
238-247 (10) AFSQKPAQSR PA
1
249-263 (15) FYHPQSSSANSPSEK PA
1
283-292 (10) EHHCQTLVLK PA
1
306-313 (8) ECENMFPK PA
1
321-334 (14) SPELTSNLFNIYGK PA
1
335-353 (19) SPLIVYFLQNYASLQQHGK PA
1
363-385 (23) TTSTPDCTPTYTDVISETLCSMK PA
1
389-407 (19) DNLNQLYQHHWTEWNYFDK PA
1
411-418 (8) ELQDNFSR PA
1
433-450 (18) ANHMFIPPSAVNEESPDK PA
1
464-477 (14) ETEVEHFFPLTSKP PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center