Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_F8VTS6-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
17-25 (9) DLEEAVQLK PA
1
26-40 (15) CGYACCLQCLNSLQK PA
1
41-50 (10) EPDGEGLLCR PA
1
51-58 (8) FCSVVSQK PA
1
83-90 (8) SVLTMNPR PA
1
94-116 (23) FQVDMTFDVDTANNYLIISEDLR PA
1
120-127 (8) SGDLSQNR PA
1
134-145 (12) FDTALCVLGTPR PA
1
151-169 (19) HYWEVDVGTSQVWDVGVCK PA
1
178-192 (15) IELSSEHGFLTVGCR PA
0
196-215 (20) VFAASTVPMTPLWVSPQLHR PA
1
216-225 (10) VGIFLDVGMR PA
1
226-257 (32) SIAFYNVSDGCHINTFIEIPVCEPWRPFFAHK PA
0
259-287 (29) GSQDDQSILSICSVINPSTASAPVSSEGK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center