Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_H3BNL1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-19 (19) MQSALVGSWHNNGFYGHYR PA
0
29-45 (17) EYHLAAKPQPPAVFLQR PA
0
67-77 (11) GPYCLLQGIGR PA
0
93-101 (9) WAPCEIELR PA
0
102-139 (38) QQGPLESSYQADFRPGPGLSGLPQHLIHFVQVQPSHTR PA
0
140-159 (20) TTYQQNFCCPSQGGHYGSYK PA
0
160-180 (21) VGPQAPVTDVLPDLPGIPRPK PA
0
181-198 (18) LLQHYLHAGVSECLNWSR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center