Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_H3BNL8-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
6-14 (9) FSCTQIWVK PA
0
15-24 (10) MYGYFAGLCR PA
0
46-57 (12) IPSAETYFHEEK PA
0
58-74 (17) IVVLGQVLMNESLPIEK PA
0
82-116 (35) IGLLAFTGGPPAGNFAAEYMEEVAHLLQDEELAPK PA
0
119-137 (19) ILLLQSVACWCYLNPVSQK PA
0
141-155 (15) SLQFIPILISFFEGR PA
0
162-171 (10) SETNSYLLLK PA
0
172-190 (19) FWTCYVLSVMTCNNLSCVK PA
0
200-229 (30) YHLQMLAAENWSGWTENFAEVLYFLIGFHR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center