Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_K7EJ46-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-18 (18) MAVSTEELEATVQEVLGR PA
2
21-64 (44) SHQFFQSTWDTVAFIVFLTFMGTVLLLLLLVVAHCCCCSSPGPR PA
2
75-83 (9) GVDNLALEP PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center