Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_M0QZC1-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-10 (10) MPCPRPFWLR PA
0
14-30 (17) APQGSGPSSPGSLSAPR PA
0
35-76 (42) GEDQEEEEEEEGDGSPGSGPILPPASPVECLICVSSFDGVFK PA
0
81-94 (14) LDCGHVFCLECLAR PA
0
95-112 (18) LSLATAGGGNAVACPVCR PA
0
122-135 (14) GLPALPTQSGLLPR PA
0
154-168 (15) GLLYLRPPPPPPGPR PA
0
172-180 (9) APPPPPPLR PA
0
189-297 (109) LSLASPAWVFNAAVALAVLVAAGLVVSGVYIFFLIPHATSSGPPRPQLVALAPAPGFSWFPPRPPPGSPWAPAWTPRPTGPDLDTALPGTAEDALEPEAGPEDPAEAER PA
0
303-320 (18) SDGTWGTEAGPGWAPWPR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center