Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O00148-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-31 (31) MAEQDVENDLLDYDEEEEPQAPQESTPAPPK PA
1
36-47 (12) GSYVSIHSSGFR PA
3
48-57 (10) DFLLKPELLR PA
3
58-89 (32) AIVDCGFEHPSEVQHECIPQAILGMDVLCQAK PA
3
95-122 (28) TAVFVLATLQQIEPVNGQVTVLVMCHTR PA
1
123-130 (8) ELAFQISK PA
3
144-154 (11) VSVFFGGLSIK PA
1
163-174 (12) NCPHVVVGTPGR PA
1
191-199 (9) HFVLDECDK PA
1
200-207 (8) MLEQLDMR PA
3
222-232 (11) QCMMFSATLSK PA
1
241-255 (15) FMQDPMEVFVDDETK PA
1
256-267 (12) LTLHGLQQYYVK PA
3
277-316 (40) LFDLLDVLEFNQPVTLSAVQGFPAADPGGHQSVWPGDGHR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center