Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O00175-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-40 (40) MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSK PA
0
47-55 (9) VVSYQLSSR PA
0
61-68 (8) AGVIFTTK PA
0
70-78 (9) GQQFCGDPK PA
0
112-119 (8) YPGNQTTC PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center