Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O00189-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-11 (11) MISQFFILSSK PA
0
28-35 (8) DVAELFYR PA
0
37-54 (18) LTGLPGDESPVVMHHHGR PA
0
61-85 (25) HSGLYLVVTTSENVSPFSLLELLSR PA
0
86-104 (19) LATLLGDYCGSLGEGTISR PA
0
105-131 (27) NVALVYELLDEVLDYGYVQTTSTEMLR PA
0
132-163 (32) NFIQTEAVVSKPFSLFDLSSVGLFGAETQQSK PA
0
164-178 (15) VAPSSAASRPVLSSR PA
0
185-194 (10) NEVFLDVVER PA
0
195-207 (13) LSVLIASNGSLLK PA
0
208-215 (8) VDVQGEIR PA
0
218-227 (10) SFLPSGSEMR PA
0
228-238 (11) IGLTEEFCVGK PA
0
250-268 (19) VDEVSFHSSVNLDEFESHR PA
0
272-283 (12) LQPPQGELTVMR PA
0
284-297 (14) YQLSDDLPSPLPFR PA
0
298-306 (9) LFPSVQWDR PA
0
339-353 (15) GVVSLSQELSSPEQK PA
0
354-362 (9) AELAEGALR PA
0
368-413 (46) VQGGSQLSGLFQMDVPGPPGPPSHGLSTSASPLGLGPASLSFELPR PA
0
414-422 (9) HTCSGLQVR PA
0
426-438 (13) LAFRPCGNANPHK PA
0
442-452 (11) HLSHSDAYVIR PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center