Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O00267-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-17 (17) MSDSEDSNFSEEEDSER PA
1
18-30 (13) SSDGEEAEVDEER PA
1
39-68 (30) EEEPEDEEEEEEEEEYDEEEEEEDDDRPPK PA
1
72-102 (31) HGGFILDEADVDDEYEDEDQWEDGAEDILEK PA
1
103-119 (17) EEIEASNIDNVVLDEDR PA
0
134-143 (10) EEELGEYYMK PA
1
148-175 (28) SSVGETVYGGSDELSDDITQQQLLPGVK PA
1
176-183 (8) DPNLWTVK PA
1
191-198 (8) ATAISLMR PA
1
200-213 (14) FIAYQFTDTPLQIK PA
1
214-222 (9) SVVAPEHVK PA
1
223-231 (9) GYIYVEAYK PA
1
237-246 (10) QAIEGVGNLR PA
1
247-258 (12) LGYWNQQMVPIK PA
1
269-276 (8) EVANLKPK PA
1
288-306 (19) DDIAQVDYVEPSQNTISLK PA
1
347-365 (19) SLGGDVASDGDFLIFEGNR PA
1
375-395 (21) SFAMSAVITEGVKPTLSELEK PA
1
396-414 (19) FEDQPEGIDLEVVTESTGK PA
1
417-439 (23) EHNFQPGDNVEVCEGELINLQGK PA
1
440-447 (8) ILSVDGNK PA
1
459-469 (11) DMLEFPAQELR PA
1
485-494 (10) FEGDTGLIVR PA
1
495-512 (18) VEENFVILFSDLTMHELK PA
1
517-552 (36) DLQLCSETASGVDVGGQHEWGELVQLDPQTVGVIVR PA
1
556-566 (11) ETFQVLNMYGK PA
1
583-597 (15) FAVALDSEQNNIHVK PA
1
602-610 (9) VIDGPHSGR PA
1
620-627 (8) SFAFLHCK PA
1
629-639 (11) LVENGGMFVCK PA
1
642-652 (11) HLVLAGGSKPR PA
1
653-668 (16) DVTNFTVGGFAPMSPR PA
1
669-681 (13) ISSPMHPSAGGQR PA
1
682-696 (15) GGFGSPGGGSGGMSR PA
1
702-711 (10) DNELIGQTVR PA
1
726-733 (8) DATESTAR PA
1
734-747 (14) VELHSTCQTISVDR PA
1
757-767 (11) RPGGMTSTYGR PA
1
768-783 (16) TPMYGSQTPMYGSGSR PA
1
784-798 (15) TPMYGSQTPLQDGSR PA
1
799-813 (15) TPHYGSQTPLHDGSR PA
1
814-831 (18) TPAQSGAWDPNNPNTPSR PA
1
832-987 (156) AEEEYEYAFDDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQGSYQPSPSPQSY
HQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSPMTPGAPSPGGYNPHTPGSGIEQNSSDWVTTDIQVK PA
1
990-1005 (16) DTYLDTQVVGQTGVIR PA
1
1006-1017 (12) SVTGGMCSVYLK PA
1
1022-1037 (16) VVSISSEHLEPITPTK PA
1
1050-1066 (17) EATGVLLSIDGEDGIVR PA
1
1067-1074 (8) MDLDEQLK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center