Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O00267-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-17 (17) MSDSEDSNFSEEEDSER PA
1
18-30 (13) SSDGEEAEVDEER PA
1
39-68 (30) EEEPEDEEEEEEEEEYDEEEEEEDDDRPPK PA
1
72-102 (31) HGGFILDEADVDDEYEDEDQWEDGAEDILEK PA
1
103-115 (13) ASNIDNVVLDEDR PA
0
130-139 (10) EEELGEYYMK PA
1
144-171 (28) SSVGETVYGGSDELSDDITQQQLLPGVK PA
1
172-179 (8) DPNLWTVK PA
1
187-194 (8) ATAISLMR PA
1
196-209 (14) FIAYQFTDTPLQIK PA
1
210-218 (9) SVVAPEHVK PA
1
219-227 (9) GYIYVEAYK PA
1
233-242 (10) QAIEGVGNLR PA
1
243-254 (12) LGYWNQQMVPIK PA
1
265-272 (8) EVANLKPK PA
1
284-302 (19) DDIAQVDYVEPSQNTISLK PA
1
343-361 (19) SLGGDVASDGDFLIFEGNR PA
1
371-391 (21) SFAMSAVITEGVKPTLSELEK PA
1
392-410 (19) FEDQPEGIDLEVVTESTGK PA
1
413-435 (23) EHNFQPGDNVEVCEGELINLQGK PA
1
436-443 (8) ILSVDGNK PA
1
455-465 (11) DMLEFPAQELR PA
1
481-490 (10) FEGDTGLIVR PA
1
491-508 (18) VEENFVILFSDLTMHELK PA
1
513-548 (36) DLQLCSETASGVDVGGQHEWGELVQLDPQTVGVIVR PA
1
552-562 (11) ETFQVLNMYGK PA
1
579-593 (15) FAVALDSEQNNIHVK PA
1
598-606 (9) VIDGPHSGR PA
1
616-623 (8) SFAFLHCK PA
1
625-635 (11) LVENGGMFVCK PA
1
638-648 (11) HLVLAGGSKPR PA
1
649-664 (16) DVTNFTVGGFAPMSPR PA
1
665-677 (13) ISSPMHPSAGGQR PA
1
678-692 (15) GGFGSPGGGSGGMSR PA
1
698-707 (10) DNELIGQTVR PA
1
722-729 (8) DATESTAR PA
1
730-743 (14) VELHSTCQTISVDR PA
1
753-763 (11) RPGGMTSTYGR PA
1
764-779 (16) TPMYGSQTPMYGSGSR PA
1
780-794 (15) TPMYGSQTPLQDGSR PA
1
795-809 (15) TPHYGSQTPLHDGSR PA
1
810-827 (18) TPAQSGAWDPNNPNTPSR PA
1
828-983 (156) AEEEYEYAFDDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFSPYAAPSPQGSYQPSPSPQSY
HQVAPSPAGYQNTHSPASYHPTPSPMAYQASPSPSPVGYSPMTPGAPSPGGYNPHTPGSGIEQNSSDWVTTDIQVK PA
1
986-1001 (16) DTYLDTQVVGQTGVIR PA
1
1002-1013 (12) SVTGGMCSVYLK PA
1
1018-1033 (16) VVSISSEHLEPITPTK PA
1
1046-1062 (17) EATGVLLSIDGEDGIVR PA
1
1063-1070 (8) MDLDEQLK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center