Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O00291-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
10-17 (8) QVPNPLPK PA
1
23-33 (11) GVGAGLEAAER PA
1
39-46 (8) TQTVSINK PA
1
47-56 (10) AINTQEVAVK PA
1
62-71 (10) TCILGTHHEK PA
1
72-82 (11) GAQTFWSVVNR PA
1
83-94 (12) LPLSSNAVLCWK PA
1
105-112 (8) DGHPNVLK PA
1
119-126 (8) NELSDMSR PA
1
127-144 (18) MWGHLSEGYGQLCSIYLK PA
1
159-168 (10) FPGNLQMSDR PA
1
169-210 (42) QLDEAGESDVNNFFQLTVEMFDYLECELNLFQTVFNSLDMSR PA
1
211-221 (11) SVSVTAAGQCR PA
1
222-241 (20) LAPLIQVILDCSHLYDYTVK PA
1
246-259 (14) LHSCLPADTLQGHR PA
3
276-283 (8) SSNLQYFK PA
1
285-300 (16) LIQIPQLPENPPNFLR PA
1
301-329 (29) ASALSEHISPVVVIPAEASSPDSEPVLEK PA
1
330-346 (17) DDLMDMDASQQNLFDNK PA
1
347-370 (24) FDDIFGSSFSSDPFNFNSQNGVNK PA
1
407-423 (17) GHVSELEADLAEQQHLR PA
1
424-434 (11) QQAADDCEFLR PA
1
475-487 (13) YSELVQNHADLLR PA
1
501-508 (8) QAQVDLER PA
1
512-519 (8) ELEDSLER PA
1
528-539 (12) TQEQLEVLESLK PA
1
540-547 (8) QELATSQR PA
1
548-575 (28) ELQVLQGSLETSAQSEANWAAEFAELEK PA
1
578-587 (10) DSLVSGAAHR PA
1
588-595 (8) EEELSALR PA
1
597-604 (8) ELQDTQLK PA
1
605-617 (13) LASTEESMCQLAK PA
1
630-673 (44) AAEQVIQDALNQLEEPPLISCAGSADHLLSTVTSISSCIEQLEK PA
1
674-712 (39) SWSQYLACPEDISGLLHSITLLAHLTSDAIAHGATTCLR PA
1
713-726 (14) APPEPADSLTEACK PA
1
731-754 (24) ETLAYLASLEEEGSLENADSTAMR PA
1
762-770 (9) AIGEELLPR PA
1
776-785 (10) QEELGDLVDK PA
1
786-800 (15) EMAATSAAIETATAR PA
1
823-842 (20) ILGCCTSLMQAIQVLIVASK PA
0
868-877 (10) WTEGLISASK PA
2
878-897 (20) AVGWGATVMVDAADLVVQGR PA
1
900-922 (23) FEELMVCSHEIAASTAQLVAASK PA
1
928-940 (13) DSPNLAQLQQASR PA
1
941-957 (17) GVNQATAGVVASTISGK PA
1
958-977 (20) SQIEETDNMDFSSMTLTQIK PA
1
979-986 (8) QEMDSQVR PA
1
987-996 (10) VLELENELQK PA
1
1008-1036 (29) HYELAGVAEGWEEGTEASPPTLQEVVTEK PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center