Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O00311-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-19 (19) MEASLGIQMDEPMAFSPQR PA
0
22-29 (8) FQAEGSLK PA
0
47-59 (13) LYEAVPQLSNVFK PA
0
64-86 (23) IGEGTFSSVYLATAQLQVGPEEK PA
0
91-100 (10) HLIPTSHPIR PA
0
101-121 (21) IAAELQCLTVAGGQDNVMGVK PA
0
127-155 (29) NDHVVIAMPYLEHESFLDILNSLSFQEVR PA
0
156-163 (8) EYMLNLFK PA
0
168-176 (9) IHQFGIVHR PA
0
177-187 (11) DVKPSNFLYNR PA
0
192-207 (16) YALVDFGLAQGTHDTK PA
0
213-222 (10) FVQSEAQQER PA
0
228-235 (8) SHIITGNK PA
0
236-244 (9) IPLSGPVPK PA
0
245-253 (9) ELDQQSTTK PA
0
258-268 (11) RPYTNAQIQIK PA
0
275-284 (10) EGSVGLSVQR PA
0
291-306 (16) NFNIHSSISHESPAVK PA
0
332-339 (8) VMNSAVMR PA
0
341-358 (18) TASSCPASLTCDCYATDK PA
0
359-366 (8) VCSICLSR PA
0
388-411 (24) CPNQTTAIDMWSAGVIFLSLLSGR PA
0
417-431 (15) ASDDLTALAQIMTIR PA
0
452-459 (8) EVPAQDLR PA
0
467-474 (8) GMDSSTPK PA
0
475-492 (18) LTSDIQGHASHQPAISEK PA
0
497-514 (18) ASCLVQTPPGQYSGNSFK PA
0
516-548 (33) GDSNSCEHCFDEYNTNLEGWNEVPDEAYDLLDK PA
0
549-557 (9) LLDLNPASR PA
0
558-570 (13) ITAEEALLHPFFK PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center