Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O00321-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-19 (19) MDLWNWDEASPQEVPPGNK PA
1
33-55 (23) VWGGCPGGASADPNPLSPAEGAK PA
0
56-79 (24) LGFCFPDLALQGDTPTATAETCWK PA
1
80-172 (93) GTSSSLASFPQLDWGSALLHPEVPWGAEPDSQALPWSGDWTDMACTAWDSWSGASQTLGPAPLGPGPIPAAGSEGAAGQN
CVPVAGEATSWSR PA
1
173-203 (31) AQAAGSNTSWDCSVGPDGDTYWGSGLGGEPR PA
1
204-235 (32) TDCTISWGGPAGPDCTTSWNPGLHAGGTTSLK PA
1
237-254 (18) YQSSALTVCSEPSPQSDR PA
1
267-284 (18) GPIQLWQFLLELLHDGAR PA
1
296-303 (8) EFQLCDPK PA
1
315-322 (8) KPGMNYEK PA
1
352-365 (14) VPSLAYPDCAGGGR PA
1
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2018 (C) Yonsei Proteome Research Center