Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O00418-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-9 (9) MADEDLIFR PA
0
10-20 (11) LEGVDGGQSPR PA
0
21-55 (35) AGHDGDSDGDSDDEEGYFICPITDDPSSNQNVNSK PA
0
69-82 (14) YSSSGSPANSFHFK PA
0
94-111 (18) HMPDPWAEFHLEDIATER PA
0
117-132 (16) YNAVTGEWLDDEVLIK PA
0
133-140 (8) MASQPFGR PA
0
152-162 (11) LSNFLHAQQWK PA
0
163-170 (8) GASNYVAK PA
0
179-186 (8) DVYFEDVR PA
0
193-200 (8) LWGEEYNR PA
0
206-218 (13) QVDIMQMCIIELK PA
0
219-235 (17) DRPGKPLFHLEHYIEGK PA
0
239-247 (9) YNSNSGFVR PA
0
253-265 (13) LTPQAFSHFTFER PA
0
266-303 (38) SGHQLIVVDIQGVGDLYTDPQIHTETGTDFGDGNLGVR PA
0
304-316 (13) GMALFFYSHACNR PA
0
317-331 (15) ICESMGLAPFDLSPR PA
0
334-341 (8) DAVNQNTK PA
0
364-406 (43) TLSGSRPPLLRPLSENSGDENMSDVTFDSLPSSPSSATPHSQK PA
0
407-424 (18) LDHLHWPVFSDLDNMASR PA
0
425-433 (9) DHDHLDNHR PA
0
434-447 (14) ESENSGDSGYPSEK PA
0
449-457 (9) GELDDPEPR PA
0
458-466 (9) EHGHSYSNR PA
0
468-480 (13) YESDEDSLGSSGR PA
0
486-493 (8) WNLLNSSR PA
0
499-508 (10) ASAVALEVQR PA
0
509-516 (8) LNALDLEK PA
0
543-588 (46) GEEWDQESAVFHLEHAANLGELEAIVGLGLMYSQLPHHILADVSLK PA
0
611-618 (8) QSMILVAR PA
0
619-630 (12) AFDSGQNLSPDR PA
0
631-664 (34) CQDWLEALHWYNTALEMTDCDEGGEYDGMQDEPR PA
0
671-684 (14) EAEMLFTGGYGLEK PA
0
689-705 (17) SGDLYTQAAEAAMEAMK PA
0
708-715 (8) LANQYYQK PA
0
716-725 (10) AEEAWAQMEE PA
0
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center