Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O00444-3)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
28-58 (31) HPSILELYNYFEDSNYVYLVLEMCHNGEMNR PA
1
64-73 (10) VKPFSENEAR PA
2
74-94 (21) HFMHQIITGMLYLHSHGILHR PA
2
95-105 (11) DLTLSNLLLTR PA
2
111-121 (11) IADFGLATQLK PA
2
127-144 (18) HYTLCGTPNYISPEIATR PA
2
145-176 (32) SAHGLESDVWSLGCMFYTLLIGRPPFDTDTVK PA
2
182-198 (17) VVLADYEMPSFLSIEAK PA
2
199-206 (8) DLIHQLLR PA
2
213-226 (14) LSLSSVLDHPFMSR PA
2
234-268 (35) DLGTVEDSIDSGHATISTAITASSSTSISGSLFDK PA
2
271-280 (10) LLIGQPLPNK PA
2
289-316 (28) SSTDFSSSGDGNSFYTQWGNQETSNSGR PA
2
319-330 (12) VIQDAEERPHSR PA
2
341-351 (11) SGTSNSQSQAK PA
2
358-368 (11) CHSAEMLSVSK PA
2
370-378 (9) SGGGENEER PA
2
379-393 (15) YSPTDNNANIFNFFK PA
2
396-420 (25) TSSSSGSFERPDNNQALSNHLCPGK PA
2
421-449 (29) TPFPFADPTPQTETVQQWFGNLQINAHLR PA
2
451-461 (11) TTEYDSISPNR PA
2
462-471 (10) DFQGHPDLQK PA
2
486-497 (12) NSDASDNAHSVK PA
2
504-531 (28) YMTALHSKPEIIQQECVFGSDPLSEQSK PA
2
534-544 (11) GMEPPWGYQNR PA
2
548-557 (10) SITSPLVAHR PA
2
568-584 (17) AVVSILDSEEVCVELVK PA
2
585-593 (9) EYASQEYVK PA
2
594-614 (21) EVLQISSDGNTITIYYPNGGR PA
2
615-631 (17) GFPLADRPPSPTDNISR PA
2
632-640 (9) YSFDNLPEK PA
2
671-691 (21) CILMENSPGADFEVWFYDGVK PA
2
695-704 (10) TEDFIQVIEK PA
2
713-721 (9) SESEVNSLK PA
2
726-736 (11) MYMDHANEGHR PA
2
737-750 (14) ICLALESIISEEER PA
2
754-764 (11) SAPFFPIIIGR PA
2
765-773 (9) KPGSTSSPK PA
2
774-788 (15) ALSPPPSVDSNYPTR PA
2
796-837 (42) MVMHSAASPTQAPILNPSMVTNEGLGLTTTASGTDISSNSLK PA
2
854-896 (43) NVGWATQLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTR PA
2
911-929 (19) LQCLSSILLMFSNPTPNFH PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center