Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O00463-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-8 (8) MAYSEEHK PA
2
9-16 (8) GMPCGFIR PA
2
17-38 (22) QNSGNSISLDFEPSIEYQFVER PA
2
45-63 (19) CAFCHSVLHNPHQTGCGHR PA
2
64-73 (10) FCQHCILSLR PA
2
74-85 (12) ELNTVPICPVDK PA
2
102-119 (18) EVLNLYVYCSNAPGCNAK PA
2
125-154 (30) YQQVPLACCYLLQDHLQQCLFQPVQCSNEK PA
0
166-175 (10) EHLSASCQFR PA
1
185-212 (28) DVVVINLQNHEENLCPEYPVFCPNNCAK PA
1
217-236 (20) TEVDEHLAVCPEAEQDCPFK PA
1
237-245 (9) HYGCAVTDK PA
1
248-258 (11) NLQQHEHSALR PA
2
268-280 (13) NVQLEEQISDLHK PA
2
289-297 (9) IQQLAETIK PA
2
305-312 (8) QFAQLFGK PA
2
313-329 (17) NGSFLPNIQVFASHIDK PA
2
330-350 (21) SAWLEAQVHQLLQMVNQQQNK PA
2
351-364 (14) FDLRPLMEAVDTVK PA
2
367-376 (10) ITLLENNDQR PA
2
377-386 (10) LAVLEEETNK PA
2
387-395 (9) HDTHINIHK PA
2
407-416 (10) LLEGTCYNGK PA
2
430-448 (19) EAVDGHTVSIFSQSFYTSR PA
2
457-466 (10) AYLNGDGSGR PA
2
467-478 (12) GSHLSLYFVVMR PA
2
479-490 (12) GEFDSLLQWPFR PA
2
493-503 (11) VTLMLLDQSGK PA
2
505-520 (16) NIMETFKPDPNSSSFK PA
2
521-534 (14) RPDGEMNIASGCPR PA
2
535-545 (11) FVAHSVLENAK PA
2
558-568 (11) VAVDLTDLEDL PA
2
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2019 (C) Yonsei Proteome Research Center