Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O00571-1)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-35 (35) MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASK PA
0
56-64 (9) DSSGWSSSK PA
1
67-75 (9) DAYSSFGSR PA
4
102-110 (9) SDYDGIGSR PA
1
131-145 (15) SDEDDWSKPLPPSER PA
1
146-162 (17) LEQELFSGGNTGINFEK PA
4
163-199 (37) YDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTR PA
1
200-208 (9) YTRPTPVQK PA
4
219-230 (12) DLMACAQTGSGK PA
8
231-252 (22) TAAFLLPILSQIYSDGPGEALR PA
1
265-276 (12) QYPISLVLAPTR PA
4
277-287 (11) ELAVQIYEEAR PA
4
295-311 (17) VRPCVVYGGADIGQQIR PA
3
316-326 (11) GCHLLVATPGR PA
3
343-351 (9) YLVLDEADR PA
7
352-362 (11) MLDMGFEPQIR PA
9
364-373 (10) IVEQDTMPPK PA
3
377-387 (11) HTMMFSATFPK PA
3
395-407 (13) DFLDEYIFLAVGR PA
3
408-418 (11) VGSTSENITQK PA
3
419-427 (9) VVWVEESDK PA
1
429-440 (12) SFLLDLLNATGK PA
1
441-451 (11) DSLTLVFVETK PA
1
453-475 (23) GADSLEDFLYHEGYACTSIHGDR PA
3
481-488 (8) EEALHQFR PA
3
492-503 (12) SPILVATAVAAR PA
3
504-511 (8) GLDISNVK PA
1
512-528 (17) HVINFDLPSDIEEYVHR PA
3
535-548 (14) VGNLGLATSFFNER PA
1
555-564 (10) DLLDLLVEAK PA
3
565-581 (17) QEVPSWLENMAYEHHYK PA
3
593-600 (8) FSGGFGAR PA
3
604-617 (14) QSSGASSSSFSSSR PA
1
623-632 (10) SGGGGHGSSR PA
1
633-662 (30) GFGGGGYGGFYNSDGYGGNYNSQGVDWWGN PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center