Home| Contact Us

HOME SEARCH STATISTICS
Peptides (NX_O00571-2)
to neXtProt Sequence Information of Isoform
Start-end (length)PeptidesCo#
2-39 (39) MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASSFYDK PA
0
40-48 (9) DSSGWSSSK PA
1
51-59 (9) DAYSSFGSR PA
4
86-94 (9) SDYDGIGSR PA
1
115-129 (15) SDEDDWSKPLPPSER PA
1
130-146 (17) LEQELFSGGNTGINFEK PA
4
147-183 (37) YDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTR PA
1
184-192 (9) YTRPTPVQK PA
4
203-214 (12) DLMACAQTGSGK PA
8
215-236 (22) TAAFLLPILSQIYSDGPGEALR PA
1
249-260 (12) QYPISLVLAPTR PA
4
261-271 (11) ELAVQIYEEAR PA
4
279-295 (17) VRPCVVYGGADIGQQIR PA
3
300-310 (11) GCHLLVATPGR PA
3
327-335 (9) YLVLDEADR PA
7
336-346 (11) MLDMGFEPQIR PA
9
348-357 (10) IVEQDTMPPK PA
3
361-371 (11) HTMMFSATFPK PA
3
379-391 (13) DFLDEYIFLAVGR PA
3
392-402 (11) VGSTSENITQK PA
3
403-411 (9) VVWVEESDK PA
1
413-424 (12) SFLLDLLNATGK PA
1
425-435 (11) DSLTLVFVETK PA
1
437-459 (23) GADSLEDFLYHEGYACTSIHGDR PA
3
465-472 (8) EEALHQFR PA
3
476-487 (12) SPILVATAVAAR PA
3
488-495 (8) GLDISNVK PA
1
496-512 (17) HVINFDLPSDIEEYVHR PA
3
519-532 (14) VGNLGLATSFFNER PA
1
539-548 (10) DLLDLLVEAK PA
3
549-565 (17) QEVPSWLENMAYEHHYK PA
3
577-584 (8) FSGGFGAR PA
3
588-601 (14) QSSGASSSSFSSSR PA
1
607-616 (10) SGGGGHGSSR PA
1
617-646 (30) GFGGGGYGGFYNSDGYGGNYNSQGVDWWGN PA
3
: Uniquely mapped peptide
: Gene-specific peptide
: Shared peptide

#424, YPRC/BPRC, Industry-University Research Center, Yonsei Univ., Seodaemun-gu, Seoul, Korea, 120-749
Tel: +82-2-2123-6626, Fax: +82-2-393-6589
2014-2020 (C) Yonsei Proteome Research Center